PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_012640_hnhs.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 25842.6 Da    PI: 9.4038
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_012640_hnhs.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.62.4e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++ye+s+
  Bv1_012640_hnhs.t1  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEFSN 59
                        79***********************************************95 PP

2K-box107.41.7e-35761716100
               K-box   6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                         g++ ++e +a+++q+e++kL+ +i+++q+++R+l+Ge+L+sL++keL+q+e++Le+++++iRskKnelll+ ie lqkkekel++en  Lr
  Bv1_012640_hnhs.t1  76 GSNsVTEINAQYYQHESTKLRHQIQMMQNSNRNLMGECLSSLTIKELKQVENRLERGISRIRSKKNELLLADIEFLQKKEKELDHENSFLR 166
                         3335999************************************************************************************ PP

               K-box  96 kklee 100
                         +k++e
  Bv1_012640_hnhs.t1 167 AKIAE 171
                         **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.006161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-32273IPR002100Transcription factor, MADS-box
CDDcd002651.71E-42273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-32323IPR002100Transcription factor, MADS-box
PfamPF003198.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-323859IPR002100Transcription factor, MADS-box
PfamPF014868.2E-2784169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.80785175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEFSNN  60
NIRSTIEKYK KANTDGSNSV TEINAQYYQH ESTKLRHQIQ MMQNSNRNLM GECLSSLTIK  120
ELKQVENRLE RGISRIRSKK NELLLADIEF LQKKEKELDH ENSFLRAKIA EVDRLQQLNM  180
LPNDNLDLVH PFLQRDPLLT ENMLQDCSEF TDADKKILHL R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-20169169Myocyte-specific enhancer factor 2B
1tqe_R3e-20169169Myocyte-specific enhancer factor 2B
1tqe_S3e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683283.11e-162PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ388365e-99AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLA0A0J8D0V11e-162A0A0J8D0V1_BETVU; Uncharacterized protein
STRINGVIT_18s0041g01880.t011e-106(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-100MIKC_MADS family protein